SCOP 1.63: Domain d1n44a_: 1n44 A:

Lineage for d1n44a_ (1n44 A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (1 family)
   duplication: consists of four domains of the same fold

5. Family a.65.1.1: Annexin [47875] (7 proteins)

6. Protein Annexin V [47883] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (13 PDB entries)

8. Domain d1n44a_: 1n44 A: [79980]
   complexed with ca, so4; mutant

Details for d1n44a_

PDB Entry: 1n44, 3 Å

PDB Description: crystal structure of annexin v r23e mutant

SCOP Domain Sequences for d1n44a_:

Sequence; same for both SEQRES and ATOM records:

>d1n44a_ a.65.1.1 (A:) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlekamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

Timeline for d1n44a_:

• d1n44a_ is new in SCOP 1.63
  
• d1n44a_ appears in SCOP 1.65
  
• d1n44a_ appears in the current release, SCOPe 2.08