Lineage for d1n42a_ (1n42 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000040Protein Annexin V [47883] (3 species)
  7. 2000061Species Norway rat (Rattus norvegicus) [TaxId:10116] [47886] (18 PDB entries)
  8. 2000068Domain d1n42a_: 1n42 A: [79979]
    complexed with ca, so4; mutant

Details for d1n42a_

PDB Entry: 1n42 (more details), 2.1 Å

PDB Description: Crystal Structure of Annexin V R149E Mutant
PDB Compounds: (A:) annexin v

SCOPe Domain Sequences for d1n42a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n42a_ a.65.1.1 (A:) Annexin V {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alrgtvtdfsgfdgradaevlrkamkglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqemlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

SCOPe Domain Coordinates for d1n42a_:

Click to download the PDB-style file with coordinates for d1n42a_.
(The format of our PDB-style files is described here.)

Timeline for d1n42a_: