Class a: All alpha proteins [46456] (218 folds) |
Fold a.65: Annexin [47873] (1 superfamily) 5 helices; folded leaf, closed |
Superfamily a.65.1: Annexin [47874] (1 family) duplication: consists of four domains of the same fold |
Family a.65.1.1: Annexin [47875] (8 proteins) |
Protein Annexin V [47883] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (13 PDB entries) |
Domain d1n41a_: 1n41 A: [79978] |
PDB Entry: 1n41 (more details), 2.1 Å
SCOP Domain Sequences for d1n41a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n41a_ a.65.1.1 (A:) Annexin V {Rat (Rattus norvegicus)} alrgtvtdfsgfdgradaevlrkameglgtdedsilnlltarsnaqrqqiaeefktlfgr dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd tsgdykkallllcggedd
Timeline for d1n41a_: