Lineage for d1n41a_ (1n41 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444876Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 444877Superfamily a.65.1: Annexin [47874] (1 family) (S)
    duplication: consists of four domains of the same fold
  5. 444878Family a.65.1.1: Annexin [47875] (8 proteins)
  6. 444903Protein Annexin V [47883] (3 species)
  7. 444922Species Rat (Rattus norvegicus) [TaxId:10116] [47886] (13 PDB entries)
  8. 444925Domain d1n41a_: 1n41 A: [79978]

Details for d1n41a_

PDB Entry: 1n41 (more details), 2.1 Å

PDB Description: crystal structure of annexin v k27e mutant

SCOP Domain Sequences for d1n41a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n41a_ a.65.1.1 (A:) Annexin V {Rat (Rattus norvegicus)}
alrgtvtdfsgfdgradaevlrkameglgtdedsilnlltarsnaqrqqiaeefktlfgr
dlvndmkseltgkfeklivalmkpsrlydayelkhalkgagtdekvlteiiasrtpeelr
aikqayeeeygsnleddvvgdtsgyyqrmlvvllqanrdpdtaiddaqveldaqalfqag
elkwgtdeekfitilgtrsvshlrrvfdkymtisgfqieetidretsgnlenlllavvks
irsipaylaetlyyamkgagtddhtlirvivsrseidlfnirkefrknfatslysmikgd
tsgdykkallllcggedd

SCOP Domain Coordinates for d1n41a_:

Click to download the PDB-style file with coordinates for d1n41a_.
(The format of our PDB-style files is described here.)

Timeline for d1n41a_: