Lineage for d1n3ya_ (1n3y A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864111Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1864112Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1864113Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1864149Protein Integrin alpha-x beta2 [82456] (1 species)
    Leukocyte adhesion glycoprotein P150,95 alpha chain
  7. 1864150Species Human (Homo sapiens) [TaxId:9606] [82457] (1 PDB entry)
  8. 1864151Domain d1n3ya_: 1n3y A: [79976]

Details for d1n3ya_

PDB Entry: 1n3y (more details), 1.65 Å

PDB Description: crystal structure of the alpha-x beta2 integrin i domain
PDB Compounds: (A:) Integrin alpha-X

SCOPe Domain Sequences for d1n3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]}
qeqdivflidgsgsissrnfatmmnfvravisqfqrpstqfslmqfsnkfqthftfeefr
rssnplsllasvhqlqgftytataiqnvvhrlfhasygarrdaakilivitdgkkegdsl
dykdvipmadaagiiryaigvglafqnrnswkelndiaskpsqehifkvedfdalkdiqn
qlkekifai

SCOPe Domain Coordinates for d1n3ya_:

Click to download the PDB-style file with coordinates for d1n3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1n3ya_: