SCOP 1.67: Domain d1n3ub_: 1n3u B:

Lineage for d1n3ub_ (1n3u B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (9 PDB entries)

8. Domain d1n3ub_: 1n3u B: [79974]
   complexed with cl, hem

Details for d1n3ub_

PDB Entry: 1n3u, 2.58 Å

PDB Description: Crystal structure of human heme oxygenase 1 (HO-1) in complex with its substrate heme, crystal form B

SCOP Domain Sequences for d1n3ub_:

Sequence; same for both SEQRES and ATOM records:

>d1n3ub_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1n3ub_:

• d1n3ub_ first appeared in SCOP 1.63
  
• d1n3ub_ appears in SCOP 1.65
  
• d1n3ub_ appears in SCOP 1.69
  
• d1n3ub_ appears in the current release, SCOPe 2.08