SCOPe 2.06: Domain d1n3pb_: 1n3p B:

Lineage for d1n3pb_ (1n3p B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)

8. Domain d1n3pb_: 1n3p B: [79970]
   complexed with ca, mn

Details for d1n3pb_

PDB Entry: 1n3p, 2.1 Å

PDB Description: pterocarpus angolensis lectin in complex with sucrose

PDB Compounds: (B:) lectin PAL

SCOPe Domain Sequences for d1n3pb_:

Sequence; same for both SEQRES and ATOM records:

>d1n3pb_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

Timeline for d1n3pb_:

• d1n3pb_ first appeared in SCOP 1.63
  
• d1n3pb_ appears in SCOPe 2.05
  
• d1n3pb_ appears in SCOPe 2.07
  
• d1n3pb_ appears in the current release, SCOPe 2.08