Lineage for d1n3pb_ (1n3p B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042368Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)
  8. 2042382Domain d1n3pb_: 1n3p B: [79970]
    complexed with ca, mn

Details for d1n3pb_

PDB Entry: 1n3p (more details), 2.1 Å

PDB Description: Pterocarpus angolensis lectin in complex with sucrose
PDB Compounds: (B:) lectin PAL

SCOPe Domain Sequences for d1n3pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3pb_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOPe Domain Coordinates for d1n3pb_:

Click to download the PDB-style file with coordinates for d1n3pb_.
(The format of our PDB-style files is described here.)

Timeline for d1n3pb_: