SCOP 1.71: Domain d1n3ob_: 1n3o B:

Lineage for d1n3ob_ (1n3o B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries)

8. Domain d1n3ob_: 1n3o B: [79968]
   complexed with ca, mgl, mn

Details for d1n3ob_

PDB Entry: 1n3o, 2 Å

PDB Description: pterocarcpus angolensis lectin in complex with alpha-methyl glucose

SCOP Domain Sequences for d1n3ob_:

Sequence; same for both SEQRES and ATOM records:

>d1n3ob_ b.29.1.1 (B:) Legume lectin {Bloodwood tree (Pterocarpus angolensis)}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

Timeline for d1n3ob_:

• d1n3ob_ first appeared in SCOP 1.63
  
• d1n3ob_ appears in SCOP 1.69
  
• d1n3ob_ appears in SCOP 1.73
  
• d1n3ob_ appears in the current release, SCOPe 2.08