SCOP 1.73: Domain d1n3oa_: 1n3o A:

Lineage for d1n3oa_ (1n3o A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries)

8. Domain d1n3oa_: 1n3o A: [79967]

Details for d1n3oa_

PDB Entry: 1n3o, 2 Å

PDB Description: pterocarcpus angolensis lectin in complex with alpha-methyl glucose

PDB Compounds: (A:) lectin PAL

SCOP Domain Sequences for d1n3oa_:

Sequence; same for both SEQRES and ATOM records:

>d1n3oa_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

Timeline for d1n3oa_:

• d1n3oa_ first appeared in SCOP 1.63
  
• d1n3oa_ appears in SCOP 1.71
  
• d1n3oa_ appears in SCOP 1.75
  
• d1n3oa_ appears in the current release, SCOPe 2.08