SCOPe 2.04: Domain d1n3jb_: 1n3j B:

Lineage for d1n3jb_ (1n3j B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
   consists of SET domain only; dimeric

6. Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)

7. Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (5 PDB entries)

8. Domain d1n3jb_: 1n3j B: [79964]

Details for d1n3jb_

PDB Entry: 1n3j

PDB Description: structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1

PDB Compounds: (B:) Histone H3 Lysine Methyltransferase

SCOPe Domain Sequences for d1n3jb_:

Sequence; same for both SEQRES and ATOM records:

>d1n3jb_ b.85.7.2 (B:) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

Timeline for d1n3jb_:

• d1n3jb_ first appeared in SCOP 1.63
  
• d1n3jb_ appears in SCOPe 2.03
  
• d1n3jb_ appears in SCOPe 2.05
  
• d1n3jb_ appears in the current release, SCOPe 2.08