Lineage for d1n3jb_ (1n3j B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811316Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 811343Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
    consists of SET domain only; dimeric
  6. 811344Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)
  7. 811345Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (2 PDB entries)
  8. 811349Domain d1n3jb_: 1n3j B: [79964]

Details for d1n3jb_

PDB Entry: 1n3j (more details)

PDB Description: structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1
PDB Compounds: (B:) Histone H3 Lysine Methyltransferase

SCOP Domain Sequences for d1n3jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3jb_ b.85.7.2 (B:) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

SCOP Domain Coordinates for d1n3jb_:

Click to download the PDB-style file with coordinates for d1n3jb_.
(The format of our PDB-style files is described here.)

Timeline for d1n3jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n3ja_