SCOP 1.71: Domain d1n3ja_: 1n3j A:

Lineage for d1n3ja_ (1n3j A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (3 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.2: Viral histone H3 Lysine 27 Methyltransferase [82207] (1 protein)
   consists of SET domain only; dimeric

6. Protein Viral histone H3 Lysine 27 Methyltransferase [82208] (1 species)

7. Species Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId:10506] [82209] (1 PDB entry)

8. Domain d1n3ja_: 1n3j A: [79963]

Details for d1n3ja_

PDB Entry: 1n3j

PDB Description: structure and substrate of a histone h3 lysine methyltransferase from paramecium bursaria chlorella virus 1

SCOP Domain Sequences for d1n3ja_:

Sequence; same for both SEQRES and ATOM records:

>d1n3ja_ b.85.7.2 (A:) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1}
mfndrvivkksplggygvfarksfekgelveeclcivrhnddwgtaledylfsrknmsam
algfgaifnhskdpnarheltaglkrmriftikpiaigeeitisygddywlsrprltqn

Timeline for d1n3ja_:

• d1n3ja_ first appeared in SCOP 1.63
  
• d1n3ja_ appears in SCOP 1.69
  
• d1n3ja_ appears in SCOP 1.73
  
• d1n3ja_ appears in the current release, SCOPe 2.08