SCOP 1.71: Domain d1n3bc_: 1n3b C:

Lineage for d1n3bc_ (1n3b C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Dephospho-CoA kinase [75187] (3 species)

7. Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)

8. Domain d1n3bc_: 1n3b C: [79961]
   complexed with mse, so4

Details for d1n3bc_

PDB Entry: 1n3b, 1.8 Å

PDB Description: crystal structure of dephosphocoenzyme a kinase from escherichia coli

SCOP Domain Sequences for d1n3bc_:

Sequence; same for both SEQRES and ATOM records:

>d1n3bc_ c.37.1.1 (C:) Dephospho-CoA kinase {Escherichia coli}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
aiasdvarlhahylqlasqfvsqekp

Timeline for d1n3bc_:

• d1n3bc_ first appeared in SCOP 1.63
  
• d1n3bc_ appears in SCOP 1.69
  
• d1n3bc_ appears in SCOP 1.73
  
• d1n3bc_ appears in the current release, SCOPe 2.08