Lineage for d1n3ba_ (1n3b A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 242913Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 242988Protein Dephospho-CoA kinase [75187] (2 species)
  7. 242989Species Escherichia coli [TaxId:562] [82394] (1 PDB entry)
  8. 242990Domain d1n3ba_: 1n3b A: [79959]

Details for d1n3ba_

PDB Entry: 1n3b (more details), 1.8 Å

PDB Description: crystal structure of dephosphocoenzyme a kinase from escherichia coli

SCOP Domain Sequences for d1n3ba_:

Sequence, based on SEQRES records: (download)

>d1n3ba_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmia
adgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensl
ykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapd
aiasdvarlhahylqlasqfvsqe

Sequence, based on observed residues (ATOM records): (download)

>d1n3ba_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli}
mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhapeeknwlnall
hpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetqlkrtmqrddvt
rehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlasqfvsqe

SCOP Domain Coordinates for d1n3ba_:

Click to download the PDB-style file with coordinates for d1n3ba_.
(The format of our PDB-style files is described here.)

Timeline for d1n3ba_: