Lineage for d1n36s_ (1n36 S:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023082Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1023083Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 1023084Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1023085Protein Ribosomal protein S19 [54572] (2 species)
  7. 1023113Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 1023141Domain d1n36s_: 1n36 S: [79955]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36s_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1n36s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36s_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1n36s_:

Click to download the PDB-style file with coordinates for d1n36s_.
(The format of our PDB-style files is described here.)

Timeline for d1n36s_: