Lineage for d1n36r_ (1n36 R:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907572Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 907573Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 907574Protein Ribosomal protein S18 [46913] (2 species)
  7. 907600Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 907634Domain d1n36r_: 1n36 R: [79954]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36r_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1n36r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d1n36r_:

Click to download the PDB-style file with coordinates for d1n36r_.
(The format of our PDB-style files is described here.)

Timeline for d1n36r_: