SCOP 1.65: Domain d1n36r_: 1n36 R:

Lineage for d1n36r_ (1n36 R:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (15 PDB entries)

8. Domain d1n36r_: 1n36 R: [79954]
   Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36s_, d1n36t_, d1n36v_
   complexed with zn

Details for d1n36r_

PDB Entry: 1n36, 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36r_:

Sequence; same for both SEQRES and ATOM records:

>d1n36r_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1n36r_:

• d1n36r_ first appeared in SCOP 1.63
  
• d1n36r_ appears in SCOP 1.67
  
• d1n36r_ appears in the current release, SCOPe 2.08