Lineage for d1n36q_ (1n36 Q:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374797Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins)
    barrel, closed; n=5, S=8
  6. 374907Protein Ribosomal protein S17 [50304] (2 species)
  7. 374910Species Thermus thermophilus [TaxId:274] [50305] (14 PDB entries)
  8. 374923Domain d1n36q_: 1n36 Q: [79953]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36q_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1n36q_:

Click to download the PDB-style file with coordinates for d1n36q_.
(The format of our PDB-style files is described here.)

Timeline for d1n36q_: