Lineage for d1n36p_ (1n36 P:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601312Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 601313Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 601314Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 601315Protein Ribosomal protein S16 [54567] (1 species)
  7. 601316Species Thermus thermophilus [TaxId:274] [54568] (19 PDB entries)
  8. 601334Domain d1n36p_: 1n36 P: [79952]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36p_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1n36p_:

Click to download the PDB-style file with coordinates for d1n36p_.
(The format of our PDB-style files is described here.)

Timeline for d1n36p_: