Lineage for d1n36i_ (1n36 I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537343Protein Ribosomal protein S9 [54218] (2 species)
  7. 2537371Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 2537401Domain d1n36i_: 1n36 I: [79945]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36i_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d1n36i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d1n36i_:

Click to download the PDB-style file with coordinates for d1n36i_.
(The format of our PDB-style files is described here.)

Timeline for d1n36i_: