Lineage for d1n36f_ (1n36 F:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257746Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 257747Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 257748Protein Ribosomal protein S6 [54997] (1 species)
  7. 257749Species Thermus thermophilus [TaxId:274] [54998] (20 PDB entries)
  8. 257765Domain d1n36f_: 1n36 F: [79942]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36f_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1n36f_:

Click to download the PDB-style file with coordinates for d1n36f_.
(The format of our PDB-style files is described here.)

Timeline for d1n36f_: