Lineage for d1n36d_ (1n36 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523479Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2523480Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2523481Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 2523482Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 2523513Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 2523547Domain d1n36d_: 1n36 D: [79939]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36c2, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36d_

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d1n36d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36d_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d1n36d_:

Click to download the PDB-style file with coordinates for d1n36d_.
(The format of our PDB-style files is described here.)

Timeline for d1n36d_: