Lineage for d1n36c2 (1n36 C:107-207)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191177Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2191178Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2191179Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2191180Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2191206Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 2191232Domain d1n36c2: 1n36 C:107-207 [79938]
    Other proteins in same PDB: d1n36b_, d1n36c1, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36c2

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1n36c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1n36c2:

Click to download the PDB-style file with coordinates for d1n36c2.
(The format of our PDB-style files is described here.)

Timeline for d1n36c2: