Lineage for d1n36c1 (1n36 C:2-106)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256779Fold d.52: Alpha-lytic protease prodomain-like [54805] (6 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 256806Superfamily d.52.3: Prokaryotic type KH domain (pKH-domain) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 256807Family d.52.3.1: Prokaryotic type KH domain (pKH-domain) [54815] (4 proteins)
  6. 256816Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)
  7. 256817Species Thermus thermophilus [TaxId:274] [54817] (14 PDB entries)
  8. 256831Domain d1n36c1: 1n36 C:2-106 [79937]
    Other proteins in same PDB: d1n36b_, d1n36c2, d1n36d_, d1n36e1, d1n36e2, d1n36f_, d1n36g_, d1n36h_, d1n36i_, d1n36j_, d1n36k_, d1n36l_, d1n36m_, d1n36n_, d1n36o_, d1n36p_, d1n36q_, d1n36r_, d1n36s_, d1n36t_, d1n36v_
    complexed with zn

Details for d1n36c1

PDB Entry: 1n36 (more details), 3.65 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position

SCOP Domain Sequences for d1n36c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n36c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

SCOP Domain Coordinates for d1n36c1:

Click to download the PDB-style file with coordinates for d1n36c1.
(The format of our PDB-style files is described here.)

Timeline for d1n36c1: