Lineage for d1n34q_ (1n34 Q:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668521Protein Ribosomal protein S17 [50304] (2 species)
  7. 668524Species Thermus thermophilus [TaxId:274] [50305] (36 PDB entries)
  8. 668546Domain d1n34q_: 1n34 Q: [79930]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34q_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOP Domain Sequences for d1n34q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1n34q_:

Click to download the PDB-style file with coordinates for d1n34q_.
(The format of our PDB-style files is described here.)

Timeline for d1n34q_: