Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
Protein Ribosomal protein S9 [54218] (2 species) |
Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries) Uniprot P80374 |
Domain d1n34i_: 1n34 I: [79922] Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_ complexed with zn |
PDB Entry: 1n34 (more details), 3.8 Å
SCOPe Domain Sequences for d1n34i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n34i_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr apqyskr
Timeline for d1n34i_: