Lineage for d1n34e1 (1n34 E:74-154)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598221Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 598237Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)
  7. 598240Species Thermus thermophilus [TaxId:274] [54217] (18 PDB entries)
  8. 598254Domain d1n34e1: 1n34 E:74-154 [79917]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34e1

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position

SCOP Domain Sequences for d1n34e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1n34e1:

Click to download the PDB-style file with coordinates for d1n34e1.
(The format of our PDB-style files is described here.)

Timeline for d1n34e1: