| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() automatically mapped to Pfam PF00189 |
| Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
| Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
| Domain d1n34c2: 1n34 C:107-207 [79915] Other proteins in same PDB: d1n34b_, d1n34c1, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34g_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_ complexed with zn |
PDB Entry: 1n34 (more details), 3.8 Å
SCOPe Domain Sequences for d1n34c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n34c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1n34c2: