Lineage for d1n33q_ (1n33 Q:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789396Protein Ribosomal protein S17 [50304] (3 species)
  7. 1789426Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 1789450Domain d1n33q_: 1n33 Q: [79908]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, zn

Details for d1n33q_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d1n33q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOPe Domain Coordinates for d1n33q_:

Click to download the PDB-style file with coordinates for d1n33q_.
(The format of our PDB-style files is described here.)

Timeline for d1n33q_: