| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
| Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
| Protein Ribosomal protein S16 [54567] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries) |
| Domain d1n33p_: 1n33 P: [79907] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ complexed with mg, par, psu, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOP Domain Sequences for d1n33p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe
Timeline for d1n33p_: