Lineage for d1n33p_ (1n33 P:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255891Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 255892Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 255893Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 255894Protein Ribosomal protein S16 [54567] (1 species)
  7. 255895Species Thermus thermophilus [TaxId:274] [54568] (15 PDB entries)
  8. 255904Domain d1n33p_: 1n33 P: [79907]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33p_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin

SCOP Domain Sequences for d1n33p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1n33p_:

Click to download the PDB-style file with coordinates for d1n33p_.
(The format of our PDB-style files is described here.)

Timeline for d1n33p_: