Lineage for d1n33l_ (1n33 L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297600Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 297686Protein Ribosomal protein S12 [50302] (1 species)
  7. 297687Species Thermus thermophilus [TaxId:274] [50303] (14 PDB entries)
  8. 297696Domain d1n33l_: 1n33 L: [79903]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33l_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin

SCOP Domain Sequences for d1n33l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOP Domain Coordinates for d1n33l_:

Click to download the PDB-style file with coordinates for d1n33l_.
(The format of our PDB-style files is described here.)

Timeline for d1n33l_: