![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50303] (14 PDB entries) |
![]() | Domain d1n33l_: 1n33 L: [79903] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ complexed with mg, par, psu, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOP Domain Sequences for d1n33l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33l_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d1n33l_: