Lineage for d1n33j_ (1n33 J:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725134Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 725135Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 725136Protein Ribosomal protein S10 [55001] (1 species)
  7. 725137Species Thermus thermophilus [TaxId:274] [55002] (36 PDB entries)
  8. 725155Domain d1n33j_: 1n33 J: [79901]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33j_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d1n33j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33j_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1n33j_:

Click to download the PDB-style file with coordinates for d1n33j_.
(The format of our PDB-style files is described here.)

Timeline for d1n33j_: