Lineage for d1n33h_ (1n33 H:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418836Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 418837Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 418838Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 418839Protein Ribosomal protein S8 [56049] (3 species)
  7. 418846Species Thermus thermophilus [TaxId:274] [56051] (15 PDB entries)
  8. 418857Domain d1n33h_: 1n33 H: [79899]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33h_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin

SCOP Domain Sequences for d1n33h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33h_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1n33h_:

Click to download the PDB-style file with coordinates for d1n33h_.
(The format of our PDB-style files is described here.)

Timeline for d1n33h_: