Lineage for d1n33g_ (1n33 G:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540533Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 540534Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 540535Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 540536Protein Ribosomal protein S7 [47975] (3 species)
  7. 540541Species Thermus thermophilus [TaxId:274] [47977] (19 PDB entries)
  8. 540555Domain d1n33g_: 1n33 G: [79898]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, psu, zn

Details for d1n33g_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin

SCOP Domain Sequences for d1n33g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1n33g_:

Click to download the PDB-style file with coordinates for d1n33g_.
(The format of our PDB-style files is described here.)

Timeline for d1n33g_: