![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) ![]() |
![]() | Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein) |
![]() | Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species) lacks the N-terminal helix |
![]() | Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries) Uniprot P27152 |
![]() | Domain d1n33e2: 1n33 E:5-73 [79896] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ complexed with mg, par, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOPe Domain Sequences for d1n33e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr nmvevplqn
Timeline for d1n33e2: