SCOP 1.67: Domain d1n33e1: 1n33 E:74-154

Lineage for d1n33e1 (1n33 E:74-154)

Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families)
Family d.14.1.1: Translational machinery components [54212] (4 proteins)
Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)
Species Thermus thermophilus [TaxId:274] [54217] (14 PDB entries)

Domain d1n33e1: 1n33 E:74-154 [79895]
Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
complexed with mg, par, psu, zn

Details for d1n33e1

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin

SCOP Domain Sequences for d1n33e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33e1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1n33e1:

Click to download the PDB-style file with coordinates for d1n33e1.
(The format of our PDB-style files is described here.)

Timeline for d1n33e1: