| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (4 families) ![]() common motif in otherwise different folds |
| Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
| Protein Ribosomal protein S4 [55179] (2 species) also contains a Zn-binding N-terminal subdomain |
| Species Thermus thermophilus [TaxId:274] [55180] (14 PDB entries) |
| Domain d1n33d_: 1n33 D: [79894] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ complexed with mg, par, psu, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOP Domain Sequences for d1n33d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33d_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr
Timeline for d1n33d_: