![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
![]() | Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() automatically mapped to Pfam PF00189 |
![]() | Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
![]() | Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
![]() | Domain d1n33c2: 1n33 C:107-207 [79893] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33o_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ complexed with mg, par, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOPe Domain Sequences for d1n33c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1n33c2: