Lineage for d1n32k_ (1n32 K:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1374905Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 1374906Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1374996Protein Ribosomal protein S11 [53141] (2 species)
  7. 1375022Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
    Uniprot P80376
  8. 1375033Domain d1n32k_: 1n32 K: [79880]
    Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
    complexed with mg, par, zn

Details for d1n32k_

PDB Entry: 1n32 (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1n32k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n32k_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOPe Domain Coordinates for d1n32k_:

Click to download the PDB-style file with coordinates for d1n32k_.
(The format of our PDB-style files is described here.)

Timeline for d1n32k_: