SCOPe 2.02: Domain d1n32e2: 1n32 E:5-73

Lineage for d1n32e2 (1n32 E:5-73)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
   Uniprot P27152

8. Domain d1n32e2: 1n32 E:5-73 [79874]
   Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
   complexed with mg, par, zn

Details for d1n32e2

PDB Entry: 1n32, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1n32e2:

Sequence; same for both SEQRES and ATOM records:

>d1n32e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

Timeline for d1n32e2:

• d1n32e2 first appeared in SCOP 1.63
  
• d1n32e2 appears in SCOPe 2.01
  
• d1n32e2 appears in SCOPe 2.03
  
• d1n32e2 appears in the current release, SCOPe 2.08