Lineage for d1n31b_ (1n31 B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705666Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)
  6. 705785Protein Cystine C-S lyase C-des [53415] (1 species)
  7. 705786Species Synechocystis sp. [TaxId:1143] [53416] (4 PDB entries)
  8. 705792Domain d1n31b_: 1n31 B: [79868]
    complexed with cys, k, plp; mutant

Details for d1n31b_

PDB Entry: 1n31 (more details), 2.2 Å

PDB Description: Structure of A Catalytically Inactive Mutant (K223A) of C-DES with a Substrate (Cystine) Linked to the Co-Factor
PDB Compounds: (B:) L-cysteine/cystine lyase C-DES

SCOP Domain Sequences for d1n31b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n31b_ c.67.1.3 (B:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]}
tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
iracchyitdeeeinhllarladfgp

SCOP Domain Coordinates for d1n31b_:

Click to download the PDB-style file with coordinates for d1n31b_.
(The format of our PDB-style files is described here.)

Timeline for d1n31b_: