Lineage for d1n31a1 (1n31 A:9-393)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503335Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2503474Protein Cystine C-S lyase C-des [53415] (1 species)
  7. 2503475Species Synechocystis sp. [TaxId:1143] [53416] (4 PDB entries)
  8. 2503482Domain d1n31a1: 1n31 A:9-393 [79867]
    Other proteins in same PDB: d1n31a2, d1n31b2
    complexed with cys, k, plp; mutant

Details for d1n31a1

PDB Entry: 1n31 (more details), 2.2 Å

PDB Description: structure of a catalytically inactive mutant (k223a) of c-des with a substrate (cystine) linked to the co-factor
PDB Compounds: (A:) L-cysteine/cystine lyase C-DES

SCOPe Domain Sequences for d1n31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n31a1 c.67.1.3 (A:9-393) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]}
pdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlr
qalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarf
gityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqg
nypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpty
vgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqr
seflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdci
racchyitdeeeinhllarladfgp

SCOPe Domain Coordinates for d1n31a1:

Click to download the PDB-style file with coordinates for d1n31a1.
(The format of our PDB-style files is described here.)

Timeline for d1n31a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n31a2