Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.13: Putative methyltransferase TM0872, insert domain [81799] (1 family) |
Family a.60.13.1: Putative methyltransferase TM0872, insert domain [81800] (1 protein) |
Protein Putative methyltransferase TM0872, insert domain [81801] (2 species) |
Species Thermotoga maritima [TaxId:2336] [81802] (2 PDB entries) |
Domain d1n2xb1: 1n2x B:115-215 [79862] Other proteins in same PDB: d1n2xa2, d1n2xb2 complexed with sam, so4 |
PDB Entry: 1n2x (more details), 1.9 Å
SCOPe Domain Sequences for d1n2xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n2xb1 a.60.13.1 (B:115-215) Putative methyltransferase TM0872, insert domain {Thermotoga maritima [TaxId: 2336]} nrgftfereepldmrmdlesevtaqkvlnelpeeelariifeygeekrfarriarkiven rplnttldlvkavrealpsyeirrrkrhfatktfqairiyv
Timeline for d1n2xb1: