SCOPe 2.06: Domain d1n2xb1: 1n2x B:115-215

Lineage for d1n2xb1 (1n2x B:115-215)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.13: Putative methyltransferase TM0872, insert domain [81799] (1 family)

5. Family a.60.13.1: Putative methyltransferase TM0872, insert domain [81800] (1 protein)

6. Protein Putative methyltransferase TM0872, insert domain [81801] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [81802] (2 PDB entries)

8. Domain d1n2xb1: 1n2x B:115-215 [79862]
   Other proteins in same PDB: d1n2xa2, d1n2xb2
   complexed with sam, so4

Details for d1n2xb1

PDB Entry: 1n2x, 1.9 Å

PDB Description: Crystal Structure Analysis of TM0872, a Putative SAM-dependent Methyltransferase, Complexed with SAM

PDB Compounds: (B:) S-adenosyl-methyltransferase mraW

SCOPe Domain Sequences for d1n2xb1:

Sequence; same for both SEQRES and ATOM records:

>d1n2xb1 a.60.13.1 (B:115-215) Putative methyltransferase TM0872, insert domain {Thermotoga maritima [TaxId: 2336]}
nrgftfereepldmrmdlesevtaqkvlnelpeeelariifeygeekrfarriarkiven
rplnttldlvkavrealpsyeirrrkrhfatktfqairiyv

Timeline for d1n2xb1:

• d1n2xb1 first appeared in SCOP 1.63
  
• d1n2xb1 appears in SCOPe 2.05
  
• d1n2xb1 appears in SCOPe 2.07
  
• d1n2xb1 appears in the current release, SCOPe 2.08