![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
![]() | Protein Cystine C-S lyase C-des [53415] (1 species) |
![]() | Species Synechocystis sp. [TaxId:1143] [53416] (4 PDB entries) |
![]() | Domain d1n2tb_: 1n2t B: [79859] complexed with gly, k, plp; mutant |
PDB Entry: 1n2t (more details), 2 Å
SCOPe Domain Sequences for d1n2tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n2tb_ c.67.1.3 (B:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc iracchyitdeeeinhllarladfg
Timeline for d1n2tb_: