Lineage for d1n2tb_ (1n2t B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247822Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 247823Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 248050Family c.67.1.3: Cystathionine synthase-like [53402] (9 protein domains)
  6. 248143Protein Cystine C-S lyase C-des [53415] (1 species)
  7. 248144Species Synechocystis sp. [TaxId:1143] [53416] (4 PDB entries)
  8. 248150Domain d1n2tb_: 1n2t B: [79859]
    complexed with gly, k, plp; mutant

Details for d1n2tb_

PDB Entry: 1n2t (more details), 2 Å

PDB Description: C-DES Mutant K223A with GLY Covalenty Linked to the PLP-cofactor

SCOP Domain Sequences for d1n2tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2tb_ c.67.1.3 (B:) Cystine C-S lyase C-des {Synechocystis sp.}
tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
iracchyitdeeeinhllarladfg

SCOP Domain Coordinates for d1n2tb_:

Click to download the PDB-style file with coordinates for d1n2tb_.
(The format of our PDB-style files is described here.)

Timeline for d1n2tb_: