Lineage for d1n2ta_ (1n2t A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 318664Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 318665Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 318895Family c.67.1.3: Cystathionine synthase-like [53402] (11 proteins)
  6. 318995Protein Cystine C-S lyase C-des [53415] (1 species)
  7. 318996Species Synechocystis sp. [TaxId:1143] [53416] (4 PDB entries)
  8. 319001Domain d1n2ta_: 1n2t A: [79858]

Details for d1n2ta_

PDB Entry: 1n2t (more details), 2 Å

PDB Description: c-des mutant k223a with gly covalenty linked to the plp-cofactor

SCOP Domain Sequences for d1n2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2ta_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp.}
tpdrhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaql
rqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaar
fgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhq
gnypvrvlvdgaqsagslpldfsrlevdyyaftghawfagpagvgglyihgdclgeinpt
yvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicq
rseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdc
iracchyitdeeeinhllarladfg

SCOP Domain Coordinates for d1n2ta_:

Click to download the PDB-style file with coordinates for d1n2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1n2ta_: