Lineage for d1n2sa_ (1n2s A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820116Protein dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) [75102] (1 species)
  7. 820117Species Salmonella enterica serovar typhimurium [TaxId:90371] [75103] (4 PDB entries)
  8. 820118Domain d1n2sa_: 1n2s A: [79857]
    complexed with mg, nah, trs

Details for d1n2sa_

PDB Entry: 1n2s (more details), 2 Å

PDB Description: crystal structure of dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) in complex with nadh
PDB Compounds: (A:) dTDP-glucose oxidoreductase

SCOP Domain Sequences for d1n2sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]}
mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt

SCOP Domain Coordinates for d1n2sa_:

Click to download the PDB-style file with coordinates for d1n2sa_.
(The format of our PDB-style files is described here.)

Timeline for d1n2sa_: