Lineage for d1n2na_ (1n2n A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337215Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 337216Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 337217Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 337218Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 337308Species Mouse (Mus musculus) [TaxId:10090] [56515] (20 PDB entries)
  8. 337316Domain d1n2na_: 1n2n A: [79855]

Details for d1n2na_

PDB Entry: 1n2n (more details), 2.4 Å

PDB Description: crystal structure of cyanide complex of the oxygenase domain of inducible nitric oxide synthase.

SCOP Domain Sequences for d1n2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2na_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus)}
qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiw

SCOP Domain Coordinates for d1n2na_:

Click to download the PDB-style file with coordinates for d1n2na_.
(The format of our PDB-style files is described here.)

Timeline for d1n2na_: